TG009637

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 56572.300
Score 3.196
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
61.151 61.151 203.888 1,351.357 4+ 1,278.583 4+ Y[pH5N4S] 100.0
61.151 61.151 203.888 1,351.357 4+ 1,582.730 3+ Y[pH4N3S] 86.5
61.151 61.151 203.888 1,351.357 4+ 1,485.699 3+ Y[pH4N3] 60.5
61.151 61.151 203.888 1,351.357 4+ 1,700.859 2+ Y[pN] 32.5
61.151 61.151 203.888 1,351.357 4+ 1,528.713 3+ Y[pH3N3S] 29.7
61.151 61.151 203.888 1,351.357 4+ 1,431.681 3+ Y[pH3N3] 25.2
61.151 61.151 203.888 1,351.357 4+ 1,964.451 2+ Y[pH2N2] 23.6
61.151 61.151 203.888 1,351.357 4+ 1,205.809 4+ Y[pH5N4] 15.5