TG009555

From GPTWiki
Jump to navigation Jump to search
Peptide R.FQSPAGTEALFELHNISVADSAN[H5N4S2]YSCVYVDLKPPFGGSAPSER.L (PE000094)
Sequence FQSPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSER
Glycans(s) H5N4S2 (N23)
Mod(s) 57.021 (C26)
Molecular Weight 6,849.98
Charge 5+
Protein A1BG (P04217)
Spectrum File DataMS_Human_serum_MARS2_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS2 Depleted
Sample Human Serum