TG009382

From GPTWiki
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File DataMS_Human_serum_MARS14_DIA_lce04
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS14 Depleted
Sample Human Serum