TG009328

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H6N5S3]ASALFILPDQDKMEEVEAMLLPETLKR.W (PE000081)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLKR
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,400.789
Charge 5+
Protein SERPINA3 (P01011)
Spectrum File DataMS_Human_serum_MARS14_DIA_lce04
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS14 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 69981.300
Score 3.649
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
54.845 54.845 168.482 1,277.564 5+ 1,594.084 3+ Y[pH4N3] 100.0
54.845 54.845 168.482 1,277.564 5+ 1,691.116 3+ Y[pH4N3S] 83.0
54.845 54.845 168.482 1,277.564 5+ 1,418.355 3+ Y[pH2N2] 82.9
54.845 54.845 168.482 1,277.564 5+ 1,432.646 4+ Y[pH5N4S2] 55.4
54.845 54.845 168.482 1,277.564 5+ 1,359.872 4+ Y[pH5N4S] 54.1
54.845 54.845 168.482 1,277.564 5+ 1,228.075 4+ Y[pH3N3S] 47.7
54.845 54.845 168.482 1,277.564 5+ 1,540.066 3+ Y[pH3N3] 46.8
54.845 54.845 168.482 1,277.564 5+ 1,242.627 3+ Y[pN] 34.0
54.845 54.845 168.482 1,277.564 5+ 1,715.795 3+ Y[pH5N4] 30.2
54.845 54.845 168.482 1,277.564 5+ 1,364.338 3+ Y[pHN2] 19.7
54.845 54.845 168.482 1,277.564 5+ 1,523.929 4+ Y[pH6N5S2] 15.8
54.845 54.845 168.482 1,277.564 5+ 1,310.320 3+ Y[pN2] 13.7
54.845 54.845 168.482 1,277.564 5+ 1,278.845 4+ Y[pH3N4S] 3.3
54.845 54.845 168.482 1,277.564 5+ 1,863.437 2+ Y[pN] 2.1