TG008118

From GPTWiki
Jump to navigation Jump to search
Peptide R.VNQNLVYESGSLN[H5N4S2]FSKLEIQSQVDSQHVGHSVLTAK.G (PE001243)
Sequence VNQNLVYESGSLNFSKLEIQSQVDSQHVGHSVLTAK
Glycans(s) H5N4S2 (N13)
Mod(s)
Molecular Weight 6,177.791
Charge 5+
Protein APOB (P04114)
Spectrum File DataMS_Human_serum_MARS14_DIA_lce01
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction MARS14 Depleted
Sample Human Serum
Extraction OpenSWATH
Intensity 18486.600
Score 4.092
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
38.360 38.360 90.773 1,232.964 5+ 1,616.783 3+ Y[pH3N2] 100.0
38.360 38.360 90.773 1,232.964 5+ 1,376.896 4+ Y[pH4N3S] 98.1
38.360 38.360 90.773 1,232.964 5+ 1,562.765 3+ Y[pH2N2] 84.6
38.360 38.360 90.773 1,232.964 5+ 1,468.179 4+ Y[pH5N4S] 60.5
38.360 38.360 90.773 1,232.964 5+ 1,304.122 4+ Y[pH4N3] 59.6
38.360 38.360 90.773 1,232.964 5+ 1,040.530 4+ Y[pN] 51.8
38.360 38.360 90.773 1,232.964 5+ 1,454.730 3+ Y[pN2] 48.0
38.360 38.360 90.773 1,232.964 5+ 1,738.493 3+ Y[pH4N3] 47.7
38.360 38.360 90.773 1,232.964 5+ 1,387.037 3+ Y[pN] 47.5
38.360 38.360 90.773 1,232.964 5+ 1,263.609 4+ Y[pH3N3] 36.5
38.360 38.360 90.773 1,232.964 5+ 1,336.383 4+ Y[pH3N3S] 31.7
38.360 38.360 90.773 1,232.964 5+ 1,684.476 3+ Y[pH3N3] 30.6
38.360 38.360 90.773 1,232.964 5+ 1,395.405 4+ Y[pH5N4] 24.1
38.360 38.360 90.773 1,232.964 5+ 1,174.745 5+ Y[pH5N4S] 21.0
38.360 38.360 90.773 1,232.964 5+ 1,508.748 3+ Y[pHN2] 8.9