TG008012

From GPTWiki
Jump to navigation Jump to search
Peptide K.SLGNVN[H4N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE001858)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H4N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,107.271
Charge 4+
Protein A2M (P01023)
Spectrum File DataMS_Human_serum_DIA_lce04
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum