TG007220

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File DataMS_Human_serum_DIA_lce02
Method Applied Biosystems TripleTOF 6600, DIA (HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum
Extraction OpenSWATH
Intensity 133763.000
Score 4.225
FDR 0%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
52.968 52.968 157.809 1,149.928 5+ 1,478.390 3+ Y[pH3N2] 100.0
52.968 52.968 157.809 1,149.928 5+ 1,424.373 3+ Y[pH2N2] 81.9
52.968 52.968 157.809 1,149.928 5+ 1,600.101 3+ Y[pH4N3] 47.1
52.968 52.968 157.809 1,149.928 5+ 1,248.644 3+ Y[pN] 34.9
52.968 52.968 157.809 1,149.928 5+ 1,546.083 3+ Y[pH3N3] 21.6
52.968 52.968 157.809 1,149.928 5+ 1,370.355 3+ Y[pHN2] 20.5
52.968 52.968 157.809 1,149.928 5+ 1,872.463 2+ Y[pN] 15.2
52.968 52.968 157.809 1,149.928 5+ 1,316.337 3+ Y[pN2] 9.6
52.968 52.968 157.809 1,149.928 5+ 1,159.814 4+ Y[pH3N3] 4.7
52.968 52.968 157.809 1,149.928 5+ 1,200.328 4+ Y[pH4N3] 3.5
52.968 52.968 157.809 1,149.928 5+ 1,273.102 4+ Y[pH4N3S] 3.1
52.968 52.968 157.809 1,149.928 5+ 1,232.588 4+ Y[pH3N3S] 1.9
52.968 52.968 157.809 1,149.928 5+ 1,364.385 4+ Y[pH5N4S] 1.5
52.968 52.968 157.809 1,149.928 5+ 1,291.611 4+ Y[pH5N4] 1.1