TG006636

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H7N6S2]FTTAPAICHDGK.A (PE002206)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H7N6S2 (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,504.273
Charge 6+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.302 41.586 68.996 1,248.720 6+ 1,200.204 6+ Y[pH7N6S] 42.8
44.302 41.586 68.996 1,248.720 6+ 1,367.017 5+ Y[pH6N5S] 18.0
44.302 41.586 68.996 1,248.720 6+ 1,308.798 5+ Y[pH6N5] 9.7
44.302 41.586 68.996 1,248.720 6+ 1,425.236 5+ Y[pH6N5S2] 8.8
44.302 41.586 68.996 1,248.720 6+ 1,151.689 6+ Y[pH7N6] 8.2
44.302 41.586 68.996 1,248.720 6+ 1,412.667 4+ Y[pH3N3] 5.8
44.302 41.586 68.996 1,248.720 6+ 1,203.361 5+ Y[pH4N4] 5.2

Spectra

8909;EThcD;44.293;8905;1249.064;Byonic:q-value=0.00104/GPS:MinICScore=71.702
8911;HCD;44.302;8905;1249.064;