TG006633

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N6FS]FTTAPAICHDGK.A (PE001653)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N6FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 7,197.183
Charge 7+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.544 41.095 68.196 1,026.606 7+ 1,027.312 6+ Y[pH4N4F] 20.7
43.544 41.095 68.196 1,026.606 7+ 1,088.167 6+ Y[pH5N5F] 17.4
43.544 41.095 68.196 1,026.606 7+ 1,159.546 5+ Y[pH3N3F] 13.3
43.544 41.095 68.196 1,026.606 7+ 1,189.587 4+ Y[pN] 10.3
43.544 41.095 68.196 1,026.606 7+ 1,191.957 5+ Y[pH4N3F] 7.5
43.544 41.095 68.196 1,026.606 7+ 1,136.683 6+ Y[pH5N5FS] 7.4
43.544 41.095 68.196 1,026.606 7+ 1,200.162 5+ Y[pH3N4F] 7.3
43.544 41.095 68.196 1,026.606 7+ 1,232.573 5+ Y[pH4N4F] 6.4
43.544 41.095 68.196 1,026.606 7+ 1,127.136 5+ Y[pH2N3F] 6.1
43.544 41.095 68.196 1,026.606 7+ 817.737 6+ Y[pNF]* 5.3

Spectra

8110;EThcD;41.178;8105;1027.040;Byonic:q-value=0.00184/GPS:MinICScore=140.978
8112;HCD;41.186;8105;1027.040;