TG006631

From GPTWiki
Jump to navigation Jump to search
Peptide K.GYHLMSFPQSAPHGVVFLHVTYVPAQEKN[H6N5FS]FTTAPAICHDGK.A (PE001618)
Sequence GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK
Glycans(s) H6N5FS (N29)
Mod(s) 57.021 (C37)
Molecular Weight 6,994.103
Charge 5+
Protein S (P0DTC2)
Spectrum File MS_50_Covid_spike_trypsin_new2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample SARS-CoV-2 Spike Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
41.721 40.983 67.914 1,396.229 5+ 1,338.010 5+ Y[pH6N5F] 78.5
41.721 40.983 67.914 1,396.229 5+ 1,580.977 4+ Y[pH5N4F] 25.4
41.721 40.983 67.914 1,396.229 5+ 1,449.181 4+ Y[pH3N3F] 10.5
41.721 40.983 67.914 1,396.229 5+ 1,264.983 5+ Y[pH5N4F] 8.3
41.721 40.983 67.914 1,396.229 5+ 1,489.694 4+ Y[pH4N3F] 6.1
41.721 40.983 67.914 1,396.229 5+ 1,226.102 4+ Y[pNF] 5.9

Spectra

8233;EThcD;41.711;8228;1396.634;Byonic:q-value=0.00876/GPS:MinICScore=28.809
8235;HCD;41.721;8228;1396.634;