TG006444

From GPTWiki
Jump to navigation Jump to search
Peptide K.SSVITLNTNAELFN[H9N2]QSDIVAHLLSSSSSVIDALQYK.L (PE001186)
Sequence SSVITLNTNAELFNQSDIVAHLLSSSSSVIDALQYK
Glycans(s) H9N2 (N14)
Mod(s)
Molecular Weight 5,746.624
Charge 4+
Protein APOB (P04114)
Spectrum File MS_47_UO1_SERUM_DIA-15_prof
Method Orbitrap Fusion-Lumos, DIA (HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum
Extraction OpenSWATH
Intensity 651377.000
Score 3.649
FDR 0.4%

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.536 78.536 163.768 1,433.161 4+ 1,356.694 3+ Y[pN] 100.0
78.536 78.536 163.768 1,433.161 4+ 1,271.108 4+ Y[pH5N2] 19.0
78.536 78.536 163.768 1,433.161 4+ 1,424.387 3+ Y[pN2] 16.1
78.536 78.536 163.768 1,433.161 4+ 1,149.569 4+ Y[pH2N2] 10.5
78.536 78.536 163.768 1,433.161 4+ 1,109.056 4+ Y[pHN2] 5.7
78.536 78.536 163.768 1,433.161 4+ 1,230.595 4+ Y[pH4N2] 5.3
78.536 78.536 163.768 1,433.161 4+ 1,190.082 4+ Y[pH3N2] 3.8
78.536 78.536 163.768 1,433.161 4+ 1,068.542 4+ Y[pN2] 3.3
78.536 78.536 163.768 1,433.161 4+ 1,640.458 3+ Y[pH4N2] 2.9
78.536 78.536 163.768 1,433.161 4+ 1,478.405 3+ Y[pHN2] 1.9
78.536 78.536 163.768 1,433.161 4+ 1,586.440 3+ Y[pH3N2] 1.8
78.536 78.536 163.768 1,433.161 4+ 1,532.422 3+ Y[pH2N2] 1.6
78.536 78.536 163.768 1,433.161 4+ 1,289.001 3+ Y[p] 1.4