TG006393

From GPTWiki
Jump to navigation Jump to search
Peptide K.GTEDFIVESLDASFRYPQDYQFYIQN[H8N2]FTALPLNTVVPPQR.Q (PE001258)
Sequence GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR
Glycans(s) H8N2 (N26)
Mod(s)
Molecular Weight 6,398.894
Charge 4+
Protein SSR1 (P43307)
Spectrum File MS_47_UO1_HEK_2_1n
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
77.814 77.759 156.211 1,596.229 4+ 1,628.135 3+ Y[pN] 32.6
77.814 77.759 156.211 1,596.229 4+ 1,555.715 4+ Y[pH7N2] 11.7
77.814 77.759 156.211 1,596.229 4+ 1,515.202 4+ Y[pH6N2] 6.5
77.814 77.759 156.211 1,596.229 4+ 1,474.689 4+ Y[pH5N2] 5.1

Spectra

22590;EThcD;77.808;22574;1596.486;Byonic:q-value=4.76e-16/GPS:MinICScore=193.636
22592;HCD;77.814;22574;1596.486;