TG006387

From GPTWiki
Jump to navigation Jump to search
Peptide R.VVRPDSELGERPPEDN[H5N2]QSFQYDHEAFLGKEDSK.T (PE001269)
Sequence VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK
Glycans(s) H5N2 (N16)
Mod(s)
Molecular Weight 5,052.215
Charge 6+
Protein RCN1 (Q15293)
Spectrum File MS_47_UO1_HEK_1_2n
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample HEK293 Cells

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
22.677 22.693 23.752 840.042 6+ 805.180 5+ Y[pN] 100.0
22.677 22.693 23.752 840.042 6+ 1,006.223 4+ Y[pN] 30.4
22.677 22.693 23.752 840.042 6+ 910.617 5+ Y[pH2N2] 20.6
22.677 22.693 23.752 840.042 6+ 786.024 6+ Y[pH3N2] 18.4
22.677 22.693 23.752 840.042 6+ 759.016 6+ Y[pH2N2] 17.3
22.677 22.693 23.752 840.042 6+ 878.207 5+ Y[pHN2] 16.3
22.677 22.693 23.752 840.042 6+ 845.796 5+ Y[pN2] 16.2
22.677 22.693 23.752 840.042 6+ 732.007 6+ Y[pHN2] 11.9
22.677 22.693 23.752 840.042 6+ 813.033 6+ Y[pH4N2] 11.8
22.677 22.693 23.752 840.042 6+ 943.028 5+ Y[pH3N2] 11.0
22.677 22.693 23.752 840.042 6+ 955.453 4+ Y[p] 9.4
22.677 22.693 23.752 840.042 6+ 764.564 5+ Y[p] 7.5
22.677 22.693 23.752 840.042 6+ 975.438 5+ Y[pH4N2] 6.1
22.677 22.693 23.752 840.042 6+ 704.998 6+ Y[pN2] 6.0

Spectra

5055;EThcD;22.669;5054;840.045;Byonic:q-value=5.67e-05/GPS:MinICScore=124.722
5057;HCD;22.677;5054;840.045;