TG006377

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H7N6F]ASALFILPDQDKMEEVEAMLLPETLK.R (PE002176)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H7N6F (N4)
Mod(s)
Molecular Weight 5,882.592
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_31_UO1_MS2_new_measurement_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
62.236 63.047 139.160 1,467.153 4+ 1,217.816 4+ Y[pH3N5] 92.1
62.236 63.047 139.160 1,467.153 4+ 1,366.322 3+ Y[pH2N2] 58.7
62.236 63.047 139.160 1,467.153 4+ 1,349.612 4+ Y[pH5N6] 54.9
62.236 63.047 139.160 1,467.153 4+ 1,207.559 4+ Y[pH4N4] 10.5
62.236 63.047 139.160 1,467.153 4+ 1,268.586 4+ Y[pH3N6] 9.7
62.236 63.047 139.160 1,467.153 4+ 1,345.614 4+ Y[pH4N6F] 7.7
62.236 63.047 139.160 1,467.153 4+ 1,309.099 4+ Y[pH4N6] 7.4
62.236 63.047 139.160 1,467.153 4+ 1,248.073 4+ Y[pH5N4] 7.3
62.236 63.047 139.160 1,467.153 4+ 1,658.429 3+ Y[pH4N4F] 7.3
62.236 63.047 139.160 1,467.153 4+ 1,258.329 4+ Y[pH4N5] 5.9
62.236 63.047 139.160 1,467.153 4+ 1,294.844 4+ Y[pH4N5F] 5.6
62.236 63.047 139.160 1,467.153 4+ 1,335.357 4+ Y[pH5N5F] 5.4
62.236 63.047 139.160 1,467.153 4+ 1,167.046 4+ Y[pH3N4] 5.4
62.236 63.047 139.160 1,467.153 4+ 1,298.842 4+ Y[pH5N5] 5.1

Spectra

15955;EThcD;62.229;15949;1350.458;Byonic:q-value=2.75e-07/GPS:MinICScore=100000000000000000000.000
15957;HCD;62.236;15949;1350.458;