TG006280

From GPTWiki
Jump to navigation Jump to search
Peptide K.SLGNVN[H5N4S]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE000232)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H5N4S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,472.403
Charge 4+
Protein A2M (P01023)
Spectrum File MS_35_Frac_plasma_run02_fr9
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum