TG006174

From GPTWiki
Jump to navigation Jump to search
Peptide K.GSFPWQAKM[Ox]VSHHN[H5N4FS2]LTTGATLINEQWLLTTAK.N (PE002087)
Sequence GSFPWQAKMVSHHNLTTGATLINEQWLLTTAK
Glycans(s) H5N4FS2 (N14)
Mod(s) 15.995 (M9)
Molecular Weight 5,964.665
Charge 5+
Protein HP (P00738)
Spectrum File MS_35_Frac_plasma_run02_fr13
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum