TG006066

From GPTWiki
Jump to navigation Jump to search
Peptide K.YTGN[H8N7S]ASALFILPDQDKMEEVEAMLLPETLK.R (PE001102)
Sequence YTGNASALFILPDQDKMEEVEAMLLPETLK
Glycans(s) H8N7S (N4)
Mod(s)
Molecular Weight 6,392.762
Charge 4+
Protein SERPINA3 (P01011)
Spectrum File MS_35_Frac_plasma_run01_fr8_01
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction SAX-ERLICH Enrichment
Sample Human Serum