TG005828

From GPTWiki
Jump to navigation Jump to search
Peptide R.VVRPDSELGERPPEDN[H6N2]QSFQYDHEAFLGKEDSK.T (PE002023)
Sequence VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK
Glycans(s) H6N2 (N16)
Mod(s)
Molecular Weight 5,214.268
Charge 5+
Protein RCN1 (Q15293)
Spectrum File MS_51_HEK_acetone
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction
Sample HEK293 Cells