TG005441

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_51_plasma_ihilic_B2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
85.589 85.307 134.829 1,179.140 5+ 1,478.390 3+ Y[pH3N2] 59.6
85.589 85.307 134.829 1,179.140 5+ 1,424.373 3+ Y[pH2N2] 43.3
85.589 85.307 134.829 1,179.140 5+ 1,180.951 3+ Y[p] 41.2
85.589 85.307 134.829 1,179.140 5+ 1,309.616 4+ Y[pH4N3FS] 23.6
85.589 85.307 134.829 1,179.140 5+ 1,248.644 3+ Y[pN] 22.9
85.589 85.307 134.829 1,179.140 5+ 1,273.102 4+ Y[pH4N3S] 15.8
85.589 85.307 134.829 1,179.140 5+ 1,600.101 3+ Y[pH4N3] 15.2
85.589 85.307 134.829 1,179.140 5+ 1,370.355 3+ Y[pHN2] 14.4
85.589 85.307 134.829 1,179.140 5+ 1,546.083 3+ Y[pH3N3] 14.3
85.589 85.307 134.829 1,179.140 5+ 1,200.328 4+ Y[pH4N3] 11.3
85.589 85.307 134.829 1,179.140 5+ 1,316.337 3+ Y[pN2] 11.3
85.589 85.307 134.829 1,179.140 5+ 1,527.076 3+ Y[pH3N2F]* 10.2
85.589 85.307 134.829 1,179.140 5+ 1,872.463 2+ Y[pN] 7.7
85.589 85.307 134.829 1,179.140 5+ 1,159.814 4+ Y[pH3N3] 7.3
85.589 85.307 134.829 1,179.140 5+ 1,648.787 3+ Y[pH4N3F] 7.0
85.589 85.307 134.829 1,179.140 5+ 1,236.842 4+ Y[pH4N3F] 6.7
85.589 85.307 134.829 1,179.140 5+ 1,364.385 4+ Y[pH5N4S] 6.5
85.589 85.307 134.829 1,179.140 5+ 1,365.023 3+ Y[pN2F]* 6.5
85.589 85.307 134.829 1,179.140 5+ 1,473.059 3+ Y[pH2N2F]* 6.2

Spectra

18236;EThcD;85.584;18225;1179.146;Byonic:q-value=3.06e-07/GPS:MinICScore=16.861
18237;HCD;85.589;18225;1179.146;