TG005437

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000220)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S (N4)
Mod(s)
Molecular Weight 5,471.518
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_51_plasma_ihilic_B2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
78.345 78.355 118.324 1,091.709 5+ 1,478.390 3+ Y[pH3N2] 35.7
78.345 78.355 118.324 1,091.709 5+ 1,424.373 3+ Y[pH2N2] 29.6
78.345 78.355 118.324 1,091.709 5+ 1,200.328 4+ Y[pH4N3] 18.5
78.345 78.355 118.324 1,091.709 5+ 1,248.644 3+ Y[pN] 17.7
78.345 78.355 118.324 1,091.709 5+ 1,600.101 3+ Y[pH4N3] 11.3
78.345 78.355 118.324 1,091.709 5+ 1,370.355 3+ Y[pHN2] 10.7
78.345 78.355 118.324 1,091.709 5+ 1,273.102 4+ Y[pH4N3S] 9.5
78.345 78.355 118.324 1,091.709 5+ 1,159.814 4+ Y[pH3N3] 8.8
78.345 78.355 118.324 1,091.709 5+ 1,291.611 4+ Y[pH5N4] 8.2
78.345 78.355 118.324 1,091.709 5+ 1,546.083 3+ Y[pH3N3] 7.0
78.345 78.355 118.324 1,091.709 5+ 1,316.337 3+ Y[pN2] 5.5

Spectra

16613;EThcD;78.336;16603;1091.715;Byonic:q-value=6.83e-07/GPS:MinICScore=154.383
16615;HCD;78.345;16603;1091.715;