TG005418

From GPTWiki
Jump to navigation Jump to search
Peptide K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4S2]TTDFQR.A (PE000263)
Sequence NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR
Glycans(s) H5N4S2 (N28)
Mod(s)
Molecular Weight 6,250.671
Charge 6+
Protein CP (P00450)
Spectrum File MS_51_plasma_ihilic_B2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.860 44.656 38.321 1,039.785 6+ 1,231.059 4+ Y[pH3N2] 37.5
44.860 44.656 38.321 1,039.785 6+ 1,190.546 4+ Y[pH2N2] 35.3
44.860 44.656 38.321 1,039.785 6+ 1,058.750 4+ Y[pN] 35.1
44.860 44.656 38.321 1,039.785 6+ 1,322.342 4+ Y[pH4N3] 27.3
44.860 44.656 38.321 1,039.785 6+ 1,281.829 4+ Y[pH3N3] 15.9
44.860 44.656 38.321 1,039.785 6+ 1,411.330 3+ Y[pN] 13.1
44.860 44.656 38.321 1,039.785 6+ 1,189.321 5+ Y[pH5N4S] 11.6
44.860 44.656 38.321 1,039.785 6+ 1,116.294 5+ Y[pH4N3S] 11.3
44.860 44.656 38.321 1,039.785 6+ 1,150.033 4+ Y[pHN2] 11.1
44.860 44.656 38.321 1,039.785 6+ 1,109.519 4+ Y[pN2] 8.1
44.860 44.656 38.321 1,039.785 6+ 1,641.076 3+ Y[pH3N2] 7.9
44.860 44.656 38.321 1,039.785 6+ 1,587.059 3+ Y[pH2N2] 7.2
44.860 44.656 38.321 1,039.785 6+ 1,395.116 4+ Y[pH4N3S] 7.0
44.860 44.656 38.321 1,039.785 6+ 1,058.075 5+ Y[pH4N3] 5.1

Spectra

8753;EThcD;44.534;8752;1039.956;Byonic:q-value=2.63e-10/GPS:MinICScore=65.167
8755;HCD;44.544;8752;1039.956;