TG005399

From GPTWiki
Jump to navigation Jump to search
Peptide K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4S2]TTDFQR.A (PE000263)
Sequence NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR
Glycans(s) H5N4S2 (N28)
Mod(s)
Molecular Weight 6,250.671
Charge 5+
Protein CP (P00450)
Spectrum File MS_51_plasma_ihilic_B2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.860 44.784 38.625 1,247.540 5+ 1,322.342 4+ Y[pH4N3] 62.3
44.860 44.784 38.625 1,247.540 5+ 1,395.116 4+ Y[pH4N3S] 47.2
44.860 44.784 38.625 1,247.540 5+ 1,189.321 5+ Y[pH5N4S] 31.3
44.860 44.784 38.625 1,247.540 5+ 1,281.829 4+ Y[pH3N3] 26.7
44.860 44.784 38.625 1,247.540 5+ 1,587.059 3+ Y[pH2N2] 19.8
44.860 44.784 38.625 1,247.540 5+ 1,058.750 4+ Y[pN] 19.2
44.860 44.784 38.625 1,247.540 5+ 1,641.076 3+ Y[pH3N2] 17.0
44.860 44.784 38.625 1,247.540 5+ 1,354.603 4+ Y[pH3N3S] 15.9
44.860 44.784 38.625 1,247.540 5+ 1,411.330 3+ Y[pN] 14.9
44.860 44.784 38.625 1,247.540 5+ 1,190.546 4+ Y[pH2N2] 14.0
44.860 44.784 38.625 1,247.540 5+ 1,413.625 4+ Y[pH5N4] 11.4
44.860 44.784 38.625 1,247.540 5+ 1,486.399 4+ Y[pH5N4S] 9.5
44.860 44.784 38.625 1,247.540 5+ 1,533.041 3+ Y[pHN2] 5.4

Spectra

8828;EThcD;44.852;8826;1247.946;Byonic:q-value=1.09e-12/GPS:MinICScore=19.776
8830;HCD;44.860;8826;1247.946;
8911;EThcD;45.195;8905;1247.744;Byonic:q-value=3.5e-06/GPS:MinICScore=68.440
8913;HCD;45.204;8905;1247.744;