TG005349

From GPTWiki
Jump to navigation Jump to search
Peptide K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4F3S]TTDFQR.A (PE001856)
Sequence NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR
Glycans(s) H5N4F3S (N28)
Mod(s)
Molecular Weight 6,397.749
Charge 6+
Protein CP (P00450)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum