TG005344

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
59.994 60.107 74.694 1,240.319 5+ 1,386.090 4+ Y[pH4N3S] 39.2
59.994 60.107 74.694 1,240.319 5+ 1,575.024 3+ Y[pH2N2] 29.4
59.994 60.107 74.694 1,240.319 5+ 1,629.041 3+ Y[pH3N2] 26.8
59.994 60.107 74.694 1,240.319 5+ 1,399.295 3+ Y[pN] 14.7
59.994 60.107 74.694 1,240.319 5+ 1,345.577 4+ Y[pH3N3S] 12.8
59.994 60.107 74.694 1,240.319 5+ 1,049.724 4+ Y[pN] 11.1
59.994 60.107 74.694 1,240.319 5+ 1,750.752 3+ Y[pH4N3] 10.0
59.994 60.107 74.694 1,240.319 5+ 1,477.373 4+ Y[pH5N4S] 9.1
59.994 60.107 74.694 1,240.319 5+ 1,521.006 3+ Y[pHN2] 8.1

Spectra

12357;EThcD;59.815;12354;1240.519;Byonic:q-value=2.38e-13/GPS:MinICScore=92.399
12359;HCD;59.824;12354;1240.519;