TG005336

From GPTWiki
Jump to navigation Jump to search
Peptide K.NLASRPYTFHSHGITYYKEHEGAIYPDN[H5N4S2]TTDFQR.A (PE000263)
Sequence NLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQR
Glycans(s) H5N4S2 (N28)
Mod(s)
Molecular Weight 6,250.671
Charge 5+
Protein CP (P00450)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
44.232 44.470 37.208 1,247.540 5+ 1,322.342 4+ Y[pH4N3] 56.1
44.232 44.470 37.208 1,247.540 5+ 1,395.116 4+ Y[pH4N3S] 43.1
44.232 44.470 37.208 1,247.540 5+ 1,189.321 5+ Y[pH5N4S] 29.9
44.232 44.470 37.208 1,247.540 5+ 1,281.829 4+ Y[pH3N3] 27.2
44.232 44.470 37.208 1,247.540 5+ 1,058.750 4+ Y[pN] 21.1
44.232 44.470 37.208 1,247.540 5+ 1,587.059 3+ Y[pH2N2] 16.3
44.232 44.470 37.208 1,247.540 5+ 1,641.076 3+ Y[pH3N2] 15.9
44.232 44.470 37.208 1,247.540 5+ 1,354.603 4+ Y[pH3N3S] 13.7
44.232 44.470 37.208 1,247.540 5+ 1,411.330 3+ Y[pN] 13.6
44.232 44.470 37.208 1,247.540 5+ 1,413.625 4+ Y[pH5N4] 10.7
44.232 44.470 37.208 1,247.540 5+ 1,190.546 4+ Y[pH2N2] 9.8
44.232 44.470 37.208 1,247.540 5+ 1,486.399 4+ Y[pH5N4S] 8.5
44.232 44.470 37.208 1,247.540 5+ 1,231.059 4+ Y[pH3N2] 5.2
44.232 44.470 37.208 1,247.540 5+ 1,109.519 4+ Y[pN2] 5.2

Spectra

8574;EThcD;44.178;8566;1247.946;Byonic:q-value=1.58e-08/GPS:MinICScore=20.969
8577;HCD;44.188;8566;1247.946;
8590;EThcD;44.245;8579;1247.746;Byonic:q-value=1.91e-11/GPS:MinICScore=21.632
8591;HCD;44.251;8579;1247.746;
8775;EThcD;44.984;8769;1247.946;Byonic:q-value=9.58e-05/GPS:MinICScore=181.527
8777;HCD;44.993;8769;1247.946;