TG005291

From GPTWiki
Jump to navigation Jump to search
Peptide K.GGETAQSADPQWEQLNNKN[H5N4S2]LSM[Ox]PLLPADFHK.E (PE001846)
Sequence GGETAQSADPQWEQLNNKNLSMPLLPADFHK
Glycans(s) H5N4S2 (N19)
Mod(s) 15.995 (M22)
Molecular Weight 5,674.43
Charge 4+
Protein SERPIND1 (P05546)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
59.629 59.650 73.599 1,415.113 4+ 1,342.339 4+ Y[pH5N4S] 30.4
59.629 59.650 73.599 1,415.113 4+ 1,570.707 3+ Y[pH4N3] 22.7
59.629 59.650 73.599 1,415.113 4+ 1,667.738 3+ Y[pH4N3S] 11.5
59.629 59.650 73.599 1,415.113 4+ 1,516.689 3+ Y[pH3N3] 11.1
59.629 59.650 73.599 1,415.113 4+ 1,340.961 3+ Y[pHN2] 6.5
59.629 59.650 73.599 1,415.113 4+ 1,692.417 3+ Y[pH5N4] 6.4
59.629 59.650 73.599 1,415.113 4+ 1,269.565 4+ Y[pH5N4] 6.1

Spectra

12313;EThcD;59.620;12305;1415.370;Byonic:q-value=1.94e-06/GPS:MinICScore=67.135
12315;HCD;59.629;12305;1415.370;