TG005261

From GPTWiki
Jump to navigation Jump to search
Peptide K.SLGNVN[H4N3S]FTVSAEALESQELCGTEVPSVPEHGRK.D (PE001858)
Sequence SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK
Glycans(s) H4N3S (N6)
Mod(s) 57.021 (C20)
Molecular Weight 5,107.271
Charge 4+
Protein A2M (P01023)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
60.054 60.104 74.687 1,273.326 4+ 1,478.690 3+ Y[pH3N2] 54.0
60.054 60.104 74.687 1,273.326 4+ 1,424.672 3+ Y[pH2N2] 30.7
60.054 60.104 74.687 1,273.326 4+ 1,200.552 4+ Y[pH4N3] 27.2
60.054 60.104 74.687 1,273.326 4+ 1,600.400 3+ Y[pH4N3] 13.6
60.054 60.104 74.687 1,273.326 4+ 1,248.944 3+ Y[pN] 12.6
60.054 60.104 74.687 1,273.326 4+ 1,872.912 2+ Y[pN] 10.1
60.054 60.104 74.687 1,273.326 4+ 1,370.654 3+ Y[pHN2] 7.0
60.054 60.104 74.687 1,273.326 4+ 1,316.637 3+ Y[pN2] 6.8

Spectra

12414;EThcD;60.045;12403;1273.578;Byonic:q-value=0.000531/GPS:MinICScore=14.009
12416;HCD;60.054;12403;1273.578;