TG005229

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 4+
Protein A1BG (P04217)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
59.994 60.106 74.692 1,550.147 4+ 1,477.373 4+ Y[pH5N4S] 59.7
59.994 60.106 74.692 1,550.147 4+ 1,750.752 3+ Y[pH4N3] 27.6
59.994 60.106 74.692 1,550.147 4+ 1,696.734 3+ Y[pH3N3] 12.0
59.994 60.106 74.692 1,550.147 4+ 1,847.784 3+ Y[pH4N3S] 6.7
59.994 60.106 74.692 1,550.147 4+ 1,399.295 3+ Y[pN] 5.7

Spectra

12442;EThcD;60.157;12432;1550.651;Byonic:q-value=8.93e-08/GPS:MinICScore=13.081
12444;HCD;60.164;12432;1550.651;