TG005222

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_51_plasma_ihilic_B1
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
83.937 83.638 131.104 1,179.140 5+ 1,478.390 3+ Y[pH3N2] 41.6
83.937 83.638 131.104 1,179.140 5+ 1,424.373 3+ Y[pH2N2] 31.9
83.937 83.638 131.104 1,179.140 5+ 1,180.951 3+ Y[p] 29.8
83.937 83.638 131.104 1,179.140 5+ 1,248.644 3+ Y[pN] 19.8
83.937 83.638 131.104 1,179.140 5+ 1,309.616 4+ Y[pH4N3FS] 14.8
83.937 83.638 131.104 1,179.140 5+ 1,600.101 3+ Y[pH4N3] 12.1
83.937 83.638 131.104 1,179.140 5+ 1,273.102 4+ Y[pH4N3S] 11.9
83.937 83.638 131.104 1,179.140 5+ 1,400.899 4+ Y[pH5N4FS] 10.1
83.937 83.638 131.104 1,179.140 5+ 1,370.355 3+ Y[pHN2] 8.8
83.937 83.638 131.104 1,179.140 5+ 1,546.083 3+ Y[pH3N3] 8.1
83.937 83.638 131.104 1,179.140 5+ 1,527.076 3+ Y[pH3N2F]* 7.8
83.937 83.638 131.104 1,179.140 5+ 1,316.337 3+ Y[pN2] 7.7
83.937 83.638 131.104 1,179.140 5+ 1,200.328 4+ Y[pH4N3] 7.5
83.937 83.638 131.104 1,179.140 5+ 1,159.814 4+ Y[pH3N3] 6.1
83.937 83.638 131.104 1,179.140 5+ 1,236.842 4+ Y[pH4N3F] 5.6
83.937 83.638 131.104 1,179.140 5+ 1,872.463 2+ Y[pN] 5.3
83.937 83.638 131.104 1,179.140 5+ 1,364.385 4+ Y[pH5N4S] 5.1

Spectra

17946;EThcD;83.929;17934;1179.145;Byonic:q-value=7.66e-09/GPS:MinICScore=38.407
17948;HCD;83.937;17934;1179.145;