TG005209

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H6N5S3]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000260)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H6N5S3 (N4)
Mod(s)
Molecular Weight 6,418.841
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
76.209 75.827 160.817 1,281.174 5+ 1,437.158 4+ Y[pH5N4S2] 34.8
76.209 75.827 160.817 1,281.174 5+ 1,364.385 4+ Y[pH5N4S] 24.4
76.209 75.827 160.817 1,281.174 5+ 1,600.101 3+ Y[pH4N3] 24.0
76.209 75.827 160.817 1,281.174 5+ 1,424.373 3+ Y[pH2N2] 19.8
76.209 75.827 160.817 1,281.174 5+ 1,546.083 3+ Y[pH3N3] 17.0
76.209 75.827 160.817 1,281.174 5+ 1,601.215 4+ Y[pH6N5S3] 15.4
76.209 75.827 160.817 1,281.174 5+ 1,232.588 4+ Y[pH3N3S] 12.3
76.209 75.827 160.817 1,281.174 5+ 1,528.441 4+ Y[pH6N5S2] 11.0
76.209 75.827 160.817 1,281.174 5+ 1,283.358 4+ Y[pH3N4S] 10.8
76.209 75.827 160.817 1,281.174 5+ 1,248.644 3+ Y[pN] 10.6
76.209 75.827 160.817 1,281.174 5+ 1,455.668 4+ Y[pH6N5S] 9.6
76.209 75.827 160.817 1,281.174 5+ 1,697.133 3+ Y[pH4N3S] 9.1
76.209 75.827 160.817 1,281.174 5+ 1,370.355 3+ Y[pHN2] 7.6
76.209 75.827 160.817 1,281.174 5+ 1,721.812 3+ Y[pH5N4] 7.5
76.209 75.827 160.817 1,281.174 5+ 1,667.794 3+ Y[pH4N4] 5.0

Spectra

16621;EThcD;76.200;16614;1281.382;Byonic:q-value=2.29e-10/GPS:MinICScore=87.250
16623;HCD;76.209;16614;1281.382;