TG005188

From GPTWiki
Jump to navigation Jump to search
Peptide R.REGDHEFLEVPEAQEDVEATFPVHQPGN[H5N4S2]YSCSYR.T (PE000229)
Sequence REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR
Glycans(s) H5N4S2 (N28)
Mod(s) 57.021 (C31)
Molecular Weight 6,214.554
Charge 5+
Protein A1BG (P04217)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
43.102 43.145 72.735 1,240.319 5+ 1,386.090 4+ Y[pH4N3S] 57.0
43.102 43.145 72.735 1,240.319 5+ 1,629.041 3+ Y[pH3N2] 31.4
43.102 43.145 72.735 1,240.319 5+ 1,575.024 3+ Y[pH2N2] 31.9
43.102 43.145 72.735 1,240.319 5+ 1,399.295 3+ Y[pN] 20.8
43.102 43.145 72.735 1,240.319 5+ 1,345.577 4+ Y[pH3N3S] 17.6
43.102 43.145 72.735 1,240.319 5+ 1,313.316 4+ Y[pH4N3] 27.0
43.102 43.145 72.735 1,240.319 5+ 1,049.724 4+ Y[pN] 18.3
43.102 43.145 72.735 1,240.319 5+ 1,477.373 4+ Y[pH5N4S] 11.0
43.102 43.145 72.735 1,240.319 5+ 1,750.752 3+ Y[pH4N3] 9.9
43.102 43.145 72.735 1,240.319 5+ 1,521.006 3+ Y[pHN2] 9.0
43.102 43.145 72.735 1,240.319 5+ 1,696.734 3+ Y[pH3N3] 7.9

Spectra

9022;EThcD;43.013;9015;1240.524;Byonic:q-value=1.02e-17/GPS:MinICScore=32.432
9024;HCD;43.022;9015;1240.524;
9042;EThcD;43.093;9041;1240.322;Byonic:q-value=2.73e-05/GPS:MinICScore=51.928
9044;HCD;43.102;9041;1240.322;
9121;EThcD;43.419;9117;1240.523;Byonic:q-value=6.74e-14/GPS:MinICScore=70.792
9124;HCD;43.430;9117;1240.523;