TG005161

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4FS2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000254)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4FS2 (N4)
Mod(s)
Molecular Weight 5,908.671
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
70.339 70.764 147.171 1,179.140 5+ 1,478.390 3+ Y[pH3N2] 29.6
70.339 70.764 147.171 1,179.140 5+ 1,424.373 3+ Y[pH2N2] 23.9
70.339 70.764 147.171 1,179.140 5+ 1,309.616 4+ Y[pH4N3FS] 15.7
70.339 70.764 147.171 1,179.140 5+ 1,248.644 3+ Y[pN] 13.7
70.339 70.764 147.171 1,179.140 5+ 1,273.102 4+ Y[pH4N3S] 9.6
70.339 70.764 147.171 1,179.140 5+ 1,400.899 4+ Y[pH5N4FS] 9.0
70.339 70.764 147.171 1,179.140 5+ 1,527.076 3+ Y[pH3N2F]* 8.6
70.339 70.764 147.171 1,179.140 5+ 1,600.101 3+ Y[pH4N3] 8.2
70.339 70.764 147.171 1,179.140 5+ 1,546.083 3+ Y[pH3N3] 5.9
70.339 70.764 147.171 1,179.140 5+ 1,370.355 3+ Y[pHN2] 5.9
70.339 70.764 147.171 1,179.140 5+ 1,200.328 4+ Y[pH4N3] 5.3

Spectra

15300;EThcD;70.333;15287;1179.147;Byonic:q-value=1.01e-12/GPS:MinICScore=15.554
15301;HCD;70.339;15287;1179.147;