TG005149

From GPTWiki
Jump to navigation Jump to search
Peptide K.YLGN[H5N4S2]ATAIFFLPDEGKLQHLENELTHDIITK.F (PE000247)
Sequence YLGNATAIFFLPDEGKLQHLENELTHDIITK
Glycans(s) H5N4S2 (N4)
Mod(s)
Molecular Weight 5,762.613
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
65.045 58.240 113.418 1,437.158 4+ 1,364.385 4+ Y[pH5N4S] 43.1
65.045 58.240 113.418 1,437.158 4+ 1,600.101 3+ Y[pH4N3] 35.1
65.045 58.240 113.418 1,437.158 4+ 1,546.083 3+ Y[pH3N3] 16.0
65.045 58.240 113.418 1,437.158 4+ 1,697.133 3+ Y[pH4N3S] 14.0
65.045 58.240 113.418 1,437.158 4+ 1,291.611 4+ Y[pH5N4] 7.5
65.045 58.240 113.418 1,437.158 4+ 1,721.812 3+ Y[pH5N4] 6.3
65.045 58.240 113.418 1,437.158 4+ 1,248.644 3+ Y[pN] 5.4
65.045 58.240 113.418 1,437.158 4+ 1,424.373 3+ Y[pH2N2] 5.0

Spectra

12705;EThcD;58.424;12693;1437.661;Byonic:q-value=0.000812/GPS:MinICScore=113.601
12706;HCD;58.430;12693;1437.661;