TG005105

From GPTWiki
Jump to navigation Jump to search
Peptide K.SPQELLCGASLISDRWVLTAAHCLLYPPWDKN[H5N4S2]FTENDLLVR.I (PE001836)
Sequence SPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDLLVR
Glycans(s) H5N4S2 (N32)
Mod(s) 57.021 (C7), 57.021 (C23)
Molecular Weight 7,020.188
Charge 5+
Protein F2 (P00734)
Spectrum File MS_51_plasma_1ul
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
79.739 80.019 172.115 1,401.448 5+ 1,514.728 4+ Y[pH4N3] 64.5
79.739 80.019 172.115 1,401.448 5+ 1,587.501 4+ Y[pH4N3S] 52.9
79.739 80.019 172.115 1,401.448 5+ 1,343.229 5+ Y[pH5N4S] 36.6
79.739 80.019 172.115 1,401.448 5+ 1,474.214 4+ Y[pH3N3] 30.6
79.739 80.019 172.115 1,401.448 5+ 1,342.418 4+ Y[pHN2] 27.9
79.739 80.019 172.115 1,401.448 5+ 1,251.135 4+ Y[pN] 19.8
79.739 80.019 172.115 1,401.448 5+ 1,546.988 4+ Y[pH3N3S] 17.2
79.739 80.019 172.115 1,401.448 5+ 1,606.011 4+ Y[pH5N4] 15.5
79.739 80.019 172.115 1,401.448 5+ 1,678.785 4+ Y[pH5N4S] 14.2
79.739 80.019 172.115 1,401.448 5+ 1,285.010 5+ Y[pH5N4] 10.7
79.739 80.019 172.115 1,401.448 5+ 1,897.590 3+ Y[pH3N2] 8.8
79.739 80.019 172.115 1,401.448 5+ 1,843.573 3+ Y[pH2N2] 8.2
79.739 80.019 172.115 1,401.448 5+ 1,667.844 3+ Y[pN] 7.4
79.739 80.019 172.115 1,401.448 5+ 1,382.931 4+ Y[pH2N2] 6.7
79.739 80.019 172.115 1,401.448 5+ 1,423.445 4+ Y[pH3N2] 5.9

Spectra

17411;EThcD;79.730;17402;1401.451;Byonic:q-value=6.75e-10/GPS:MinICScore=30.976
17413;HCD;79.739;17402;1401.451;