TG004923

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 4+
Protein SERPINA1 (P01009)
Spectrum File MS_51_ihilic_plasma_1ul2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
88.997 89.154 171.350 1,351.357 4+ 1,278.583 4+ Y[pH5N4S] 33.0
88.997 89.154 171.350 1,351.357 4+ 1,582.730 3+ Y[pH4N3S] 14.1
88.997 89.154 171.350 1,351.357 4+ 1,485.699 3+ Y[pH4N3] 13.8
88.997 89.154 171.350 1,351.357 4+ 1,700.859 2+ Y[pN] 11.2
88.997 89.154 171.350 1,351.357 4+ 1,431.681 3+ Y[pH3N3] 8.8
88.997 89.154 171.350 1,351.357 4+ 1,964.451 2+ Y[pH2N2] 7.8
88.997 89.154 171.350 1,351.357 4+ 1,205.809 4+ Y[pH5N4] 5.1
88.997 89.154 171.350 1,351.357 4+ 1,528.713 3+ Y[pH3N3S] 5.1

Spectra

18107;EThcD;88.778;18102;1351.363;Byonic:q-value=0.00437/GPS:MinICScore=9.031
18109;HCD;88.788;18102;1351.363;