TG004872

From GPTWiki
Jump to navigation Jump to search
Peptide R.QLAHQSN[H5N4S2]STNIFFSPVSIATAFAM[Ox]LSLGTK.A (PE001184)
Sequence QLAHQSNSTNIFFSPVSIATAFAMLSLGTK
Glycans(s) H5N4S2 (N7)
Mod(s) 15.995 (M24)
Molecular Weight 5,419.406
Charge 5+
Protein SERPINA1 (P01009)
Spectrum File MS_51_ihilic_plasma_1ul2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction iHILIC
Sample Human Serum

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
88.997 89.115 171.257 1,081.287 5+ 1,187.300 4+ Y[pH4N3S] 38.7
88.997 89.115 171.257 1,081.287 5+ 1,278.583 4+ Y[pH5N4S] 27.3
88.997 89.115 171.257 1,081.287 5+ 1,114.526 4+ Y[pH4N3] 12.5
88.997 89.115 171.257 1,081.287 5+ 1,700.859 2+ Y[pN] 10.9
88.997 89.115 171.257 1,081.287 5+ 1,363.988 3+ Y[pH3N2] 8.8
88.997 89.115 171.257 1,081.287 5+ 1,205.809 4+ Y[pH5N4] 8.8
88.997 89.115 171.257 1,081.287 5+ 1,485.699 3+ Y[pH4N3] 7.2
88.997 89.115 171.257 1,081.287 5+ 1,146.786 4+ Y[pH3N3S] 6.4

Spectra

18191;EThcD;89.196;18189;1081.492;Byonic:q-value=0.00127/GPS:MinICScore=97.561
18193;HCD;89.207;18189;1081.492;