TG004848

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N6F]ITEENVQNMNNAGDKWSAFLK.E (PE001797)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N6F (N27)
Mod(s)
Molecular Weight 7,512.299
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.188 71.226 143.920 1,499.865 5+ 1,462.677 4+ Y[pN] 15.6
71.188 71.226 143.920 1,499.865 5+ 1,787.296 4+ Y[pH3N5] 9.5
71.188 71.226 143.920 1,499.865 5+ 1,773.040 4+ Y[pH3N4F] 8.7
71.188 71.226 143.920 1,499.865 5+ 1,499.191 4+ Y[pNF]* 7.7

Spectra

14461;EThcD;71.178;14459;1499.877;Byonic:q-value=1.55e-06/GPS:MinICScore=69.694
14463;HCD;71.188;14459;1499.877;