TG004835

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N5]ITEENVQNMNNAGDKWSAFLK.E (PE001761)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N5 (N27)
Mod(s)
Molecular Weight 7,163.161
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.335 68.905 138.091 1,430.038 5+ 1,736.526 4+ Y[pH3N4] 43.9
71.335 68.905 138.091 1,430.038 5+ 1,462.677 4+ Y[pN] 29.4
71.335 68.905 138.091 1,430.038 5+ 1,685.756 4+ Y[pH3N3] 13.9
71.335 68.905 138.091 1,430.038 5+ 1,645.243 4+ Y[pH2N3] 10.0

Spectra

14401;EThcD;70.917;14400;1430.041;Byonic:q-value=9.52e-19/GPS:MinICScore=29.104
14403;HCD;70.926;14400;1430.041;
14579;EThcD;71.735;14578;1430.245;Byonic:q-value=4.96e-07/GPS:MinICScore=49.923
14581;HCD;71.743;14578;1430.245;