TG004814

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4]ITEENVQNMNNAGDKWSAFLK.E (PE001766)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4 (N27)
Mod(s)
Molecular Weight 7,122.135
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.184 70.870 143.026 1,421.833 5+ 1,462.677 4+ Y[pN] 83.0
71.184 70.870 143.026 1,421.833 5+ 1,685.756 4+ Y[pH3N3] 45.5
71.184 70.870 143.026 1,421.833 5+ 1,726.269 4+ Y[pH4N3] 34.5
71.184 70.870 143.026 1,421.833 5+ 1,594.473 4+ Y[pH2N2] 16.4
71.184 70.870 143.026 1,421.833 5+ 1,634.986 4+ Y[pH3N2] 12.5
71.184 70.870 143.026 1,421.833 5+ 1,645.243 4+ Y[pH2N3] 9.2
71.184 70.870 143.026 1,421.833 5+ 1,513.446 4+ Y[pN2] 8.7
71.184 70.870 143.026 1,421.833 5+ 1,411.907 4+ Y[p] 7.5
71.184 70.870 143.026 1,421.833 5+ 1,949.899 3+ Y[pN] 5.8

Spectra

14418;EThcD;70.989;14416;1421.840;Byonic:q-value=5.35e-11/GPS:MinICScore=40.002
14420;HCD;70.999;14416;1421.840;
14502;EThcD;71.362;14501;1421.840;Byonic:q-value=0.00713/GPS:MinICScore=32.275
14503;HCD;71.369;14501;1421.840;