TG004810

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N4F]ITEENVQNMNNAGDKWSAFLK.E (PE001757)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N4F (N27)
Mod(s)
Molecular Weight 7,106.14
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.827 71.552 144.739 1,418.634 5+ 1,462.677 4+ Y[pN] 55.7
71.827 71.552 144.739 1,418.634 5+ 1,722.270 4+ Y[pH3N3F] 24.9
71.827 71.552 144.739 1,418.634 5+ 1,685.756 4+ Y[pH3N3] 24.7
71.827 71.552 144.739 1,418.634 5+ 1,499.191 4+ Y[pNF]* 15.4
71.827 71.552 144.739 1,418.634 5+ 1,594.473 4+ Y[pH2N2] 9.3
71.827 71.552 144.739 1,418.634 5+ 1,645.243 4+ Y[pH2N3] 7.1
71.827 71.552 144.739 1,418.634 5+ 1,681.757 4+ Y[pH2N3F] 6.3
71.827 71.552 144.739 1,418.634 5+ 1,389.422 5+ Y[pH3N4] 6.0
71.827 71.552 144.739 1,418.634 5+ 1,513.446 4+ Y[pN2] 5.5
71.827 71.552 144.739 1,418.634 5+ 1,634.986 4+ Y[pH3N2] 5.3

Spectra

14600;EThcD;71.821;14598;1418.643;Byonic:q-value=0.00434/GPS:MinICScore=36.244
14601;HCD;71.827;14598;1418.643;