TG004802

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H3N3]ITEENVQNMNNAGDKWSAFLK.E (PE001796)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H3N3 (N27)
Mod(s)
Molecular Weight 6,757.003
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.489 71.301 144.109 1,348.806 5+ 1,462.677 4+ Y[pN] 100.0
71.489 71.301 144.109 1,348.806 5+ 1,634.986 4+ Y[pH3N2] 35.6
71.489 71.301 144.109 1,348.806 5+ 1,594.473 4+ Y[pH2N2] 12.4
71.489 71.301 144.109 1,348.806 5+ 1,411.907 4+ Y[p] 9.6
71.489 71.301 144.109 1,348.806 5+ 1,553.960 4+ Y[pHN2] 8.4
71.489 71.301 144.109 1,348.806 5+ 1,513.446 4+ Y[pN2] 7.7

Spectra

14519;EThcD;71.443;14517;1348.815;Byonic:q-value=0.00713/GPS:MinICScore=39.014
14520;HCD;71.449;14517;1348.815;
14537;EThcD;71.522;14536;1349.014;Byonic:q-value=0.00713/GPS:MinICScore=65.565
14538;HCD;71.529;14536;1349.014;