TG004778

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H5N4S]ITEENVQNMNNAGDKWSAFLK.E (PE001763)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H5N4S (N27)
Mod(s)
Molecular Weight 7,575.283
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.813 74.637 152.487 1,512.462 5+ 1,462.677 4+ Y[pN] 64.7
74.813 74.637 152.487 1,512.462 5+ 1,685.756 4+ Y[pH3N3] 25.2
74.813 74.637 152.487 1,512.462 5+ 1,513.446 4+ Y[pN2] 17.8
74.813 74.637 152.487 1,512.462 5+ 1,726.269 4+ Y[pH4N3] 34.8
74.813 74.637 152.487 1,512.462 5+ 1,454.243 5+ Y[pH5N4] 11.4
74.813 74.637 152.487 1,512.462 5+ 1,594.473 4+ Y[pH2N2] 6.6

Spectra

15197;EThcD;74.764;15192;1512.670;Byonic:q-value=3.68e-08/GPS:MinICScore=35.702
15199;HCD;74.772;15192;1512.670;
15213;EThcD;74.844;15211;1512.471;Byonic:q-value=4.91e-08/GPS:MinICScore=35.398
15215;HCD;74.854;15211;1512.471;