TG004775

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H3N4F]STEAGQK.L (PE001772)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H3N4F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,496.45
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.369 35.369 53.864 914.085 6+ 1,228.571 4+ Y[pH2N2F]* 23.8
35.369 35.369 53.864 914.085 6+ 1,192.056 4+ Y[pH2N2] 17.1
35.369 35.369 53.864 914.085 6+ 1,269.084 4+ Y[pH3N2F]* 14.3
35.369 35.369 53.864 914.085 6+ 1,151.543 4+ Y[pHN2] 12.4
35.369 35.369 53.864 914.085 6+ 1,413.344 3+ Y[pN] 11.8
35.369 35.369 53.864 914.085 6+ 1,060.260 4+ Y[pN] 10.2
35.369 35.369 53.864 914.085 6+ 1,188.058 4+ Y[pHN2F]* 9.7
35.369 35.369 53.864 914.085 6+ 1,232.570 4+ Y[pH3N2] 8.2
35.369 35.369 53.864 914.085 6+ 1,111.030 4+ Y[pN2] 7.1

Spectra

6473;EThcD;35.360;6472;914.087;Byonic:q-value=0.00741/GPS:MinICScore=15.168
6475;HCD;35.369;6472;914.087;