TG004772

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4FS]ITEENVQNMNNAGDKWSAFLK.E (PE001762)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4FS (N27)
Mod(s)
Molecular Weight 7,559.288
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
75.344 75.223 153.959 1,509.263 5+ 1,462.677 4+ Y[pN] 89.8
75.344 75.223 153.959 1,509.263 5+ 1,722.270 4+ Y[pH3N3F] 35.8
75.344 75.223 153.959 1,509.263 5+ 1,685.756 4+ Y[pH3N3] 31.7
75.344 75.223 153.959 1,509.263 5+ 1,499.191 4+ Y[pNF]* 24.3
75.344 75.223 153.959 1,509.263 5+ 1,762.783 4+ Y[pH4N3F]* 17.5
75.344 75.223 153.959 1,509.263 5+ 1,681.757 4+ Y[pH2N3F] 16.4
75.344 75.223 153.959 1,509.263 5+ 1,594.473 4+ Y[pH2N2] 13.3
75.344 75.223 153.959 1,509.263 5+ 1,513.446 4+ Y[pN2] 10.9
75.344 75.223 153.959 1,509.263 5+ 1,553.960 4+ Y[pHN2] 10.3
75.344 75.223 153.959 1,509.263 5+ 1,411.907 4+ Y[p] 7.5
75.344 75.223 153.959 1,509.263 5+ 1,835.557 4+ Y[pH4N3FS]* 6.2
75.344 75.223 153.959 1,509.263 5+ 1,421.833 5+ Y[pH4N4] 6.2
75.344 75.223 153.959 1,509.263 5+ 1,949.899 3+ Y[pN] 5.4
75.344 75.223 153.959 1,509.263 5+ 1,773.040 4+ Y[pH3N4F] 5.0

Spectra

15317;EThcD;75.335;15316;1509.472;Byonic:q-value=1.13e-06/GPS:MinICScore=44.115
15319;HCD;75.344;15316;1509.472;