TG004752

From GPTWiki
Jump to navigation Jump to search
Peptide R.TLYQFQFQEALCQAAKHEGPLHKCDISN[H4N3F]STEAGQK.L (PE001771)
Sequence TLYQFQFQEALCQAAKHEGPLHKCDISNSTEAGQK
Glycans(s) H4N3F (N28)
Mod(s) 57.021 (C12), 57.021 (C24)
Molecular Weight 5,455.423
Charge 6+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
35.383 35.253 53.682 907.247 6+ 1,060.260 4+ Y[pN] 56.9
35.383 35.253 53.682 907.247 6+ 1,151.543 4+ Y[pHN2] 21.0
35.383 35.253 53.682 907.247 6+ 1,192.056 4+ Y[pH2N2] 19.5
35.383 35.253 53.682 907.247 6+ 1,111.030 4+ Y[pN2] 17.1
35.383 35.253 53.682 907.247 6+ 1,015.469 5+ Y[pH3N2F]* 16.1
35.383 35.253 53.682 907.247 6+ 921.436 5+ Y[pHN2] 15.8
35.383 35.253 53.682 907.247 6+ 1,413.344 3+ Y[pN] 14.0
35.383 35.253 53.682 907.247 6+ 983.058 5+ Y[pH2N2F]* 13.5
35.383 35.253 53.682 907.247 6+ 953.847 5+ Y[pH2N2] 12.6
35.383 35.253 53.682 907.247 6+ 1,232.570 4+ Y[pH3N2] 12.4
35.383 35.253 53.682 907.247 6+ 986.257 5+ Y[pH3N2] 9.2
35.383 35.253 53.682 907.247 6+ 889.026 5+ Y[pN2] 9.1
35.383 35.253 53.682 907.247 6+ 950.648 5+ Y[pHN2F]* 8.3
35.383 35.253 53.682 907.247 6+ 1,188.058 4+ Y[pHN2F]* 7.7
35.383 35.253 53.682 907.247 6+ 1,047.879 5+ Y[pH4N2F]* 7.4
35.383 35.253 53.682 907.247 6+ 1,228.571 4+ Y[pH2N2F]* 7.2
35.383 35.253 53.682 907.247 6+ 1,147.545 4+ Y[pN2F]* 6.6
35.383 35.253 53.682 907.247 6+ 848.410 5+ Y[pN] 6.3
35.383 35.253 53.682 907.247 6+ 877.621 5+ Y[pNF]* 6.2
35.383 35.253 53.682 907.247 6+ 849.058 6+ Y[pH4N2]* 5.8

Spectra

6703;EThcD;35.375;6701;907.249;Byonic:q-value=0.00106/GPS:MinICScore=26.687
6705;HCD;35.383;6701;907.249;