TG004750

From GPTWiki
Jump to navigation Jump to search
Peptide R.IFKEAEKFFVSVGLPN[H3N3F]MTQGFWENSMLTDPGNVQK.A (PE001685)
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N3F (N16)
Mod(s)
Molecular Weight 5,247.419
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
66.000 65.553 130.579 1,308.360 4+ 1,676.451 3+ Y[pH3N2F] 41.7
66.000 65.553 130.579 1,308.360 4+ 1,622.433 3+ Y[pH2N2F] 41.2
66.000 65.553 130.579 1,308.360 4+ 1,573.747 3+ Y[pH2N2] 19.5
66.000 65.553 130.579 1,308.360 4+ 1,398.019 3+ Y[pN] 17.1
66.000 65.553 130.579 1,308.360 4+ 1,627.765 3+ Y[pH3N2] 13.6
66.000 65.553 130.579 1,308.360 4+ 1,446.705 3+ Y[pNF] 9.3
66.000 65.553 130.579 1,308.360 4+ 1,568.416 3+ Y[pHN2F] 8.3
66.000 65.553 130.579 1,308.360 4+ 1,519.730 3+ Y[pHN2] 7.7
66.000 65.553 130.579 1,308.360 4+ 1,465.712 3+ Y[pN2] 6.6

Spectra

13686;EThcD;65.994;13675;1308.617;Byonic:q-value=7.92e-06/GPS:MinICScore=84.915
13687;HCD;66.000;13675;1308.617;