TG004735

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N6S]ITEENVQNMNNAGDKWSAFLK.E (PE001756)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N6S (N27)
Mod(s)
Molecular Weight 7,819.389
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
74.514 74.683 153.750 1,561.283 5+ 1,462.677 4+ Y[pN] 32.5
74.514 74.683 153.750 1,561.283 5+ 1,827.809 4+ Y[pH4N5] 9.6
74.514 74.683 153.750 1,561.283 5+ 1,736.526 4+ Y[pH3N4] 6.8
74.514 74.683 153.750 1,561.283 5+ 1,503.064 5+ Y[pH4N6] 5.8
74.514 74.683 153.750 1,561.283 5+ 1,900.583 4+ Y[pH4N5S] 5.8

Spectra

15647;EThcD;74.506;15638;1561.486;Byonic:q-value=1.5e-06/GPS:MinICScore=58.708
15649;HCD;74.514;15638;1561.486;