TG004730

From GPTWiki
Jump to navigation Jump to search
Peptide R.IFKEAEKFFVSVGLPN[H3N5F]MTQGFWENSMLTDPGNVQK.A (PE001686)
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H3N5F (N16)
Mod(s)
Molecular Weight 5,653.578
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
66.042 64.994 129.160 1,409.900 4+ 1,811.837 3+ Y[pH3N4F] 34.0
66.042 64.994 129.160 1,409.900 4+ 1,744.144 3+ Y[pH3N3F] 8.9
66.042 64.994 129.160 1,409.900 4+ 1,690.126 3+ Y[pH2N3F] 8.3
66.042 64.994 129.160 1,409.900 4+ 1,763.151 3+ Y[pH3N4] 7.0
66.042 64.994 129.160 1,409.900 4+ 1,757.819 3+ Y[pH2N4F] 5.2

Spectra

13462;EThcD;65.045;13456;1410.156;Byonic:q-value=1.2e-12/GPS:MinICScore=18.105
13464;HCD;65.057;13456;1410.156;
13695;EThcD;66.033;13688;1410.158;Byonic:q-value=2.28e-06/GPS:MinICScore=17.421
13697;HCD;66.042;13688;1410.158;
13819;EThcD;66.573;13810;1410.158;Byonic:q-value=0.000335/GPS:MinICScore=66.811
13821;HCD;66.582;13810;1410.158;