TG004720

From GPTWiki
Jump to navigation Jump to search
Peptide K.TFLDKFNHEAEDLFYQSSLASWNYNTN[H4N4]ITEENVQNMNNAGDKWSAFLK.E (PE001766)
Sequence TFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLK
Glycans(s) H4N4 (N27)
Mod(s)
Molecular Weight 7,122.135
Charge 5+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
71.653 71.029 144.476 1,421.833 5+ 1,462.677 4+ Y[pN] 60.8
71.653 71.029 144.476 1,421.833 5+ 1,685.756 4+ Y[pH3N3] 31.5
71.653 71.029 144.476 1,421.833 5+ 1,726.269 4+ Y[pH4N3] 26.0
71.653 71.029 144.476 1,421.833 5+ 1,594.473 4+ Y[pH2N2] 11.4
71.653 71.029 144.476 1,421.833 5+ 1,634.986 4+ Y[pH3N2] 7.7
71.653 71.029 144.476 1,421.833 5+ 1,513.446 4+ Y[pN2] 6.5
71.653 71.029 144.476 1,421.833 5+ 1,411.907 4+ Y[p] 5.6

Spectra

14996;EThcD;71.645;14990;1421.840;Byonic:q-value=5.59e-11/GPS:MinICScore=33.263
14998;HCD;71.653;14990;1421.840;