TG004716

From GPTWiki
Jump to navigation Jump to search
Peptide R.IFKEAEKFFVSVGLPN[H4N5FS]MTQGFWENSMLTDPGNVQK.A (PE001684)
Sequence IFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQK
Glycans(s) H4N5FS (N16)
Mod(s)
Molecular Weight 6,106.726
Charge 4+
Protein ACE2 (Q9BYF1)
Spectrum File MS_50_ACE2_Trypsin_2
Method Orbitrap Fusion-Lumos, DDA (EThcD pd HCD), nano LC-MS/MS
Analytical Fraction No enrichment
Sample Human ACE2 Protein

Transitions

Exp. R.T. Peak R.T. Norm. R.T. Prec. m/z Prec. z Prod. m/z Prod. z Label %Int
70.335 70.519 143.182 1,523.187 4+ 1,811.837 3+ Y[pH3N4F] 19.9
70.335 70.519 143.182 1,523.187 4+ 1,865.855 3+ Y[pH4N4F] 12.3
70.335 70.519 143.182 1,523.187 4+ 1,744.144 3+ Y[pH3N3F] 8.7
70.335 70.519 143.182 1,523.187 4+ 1,446.705 3+ Y[pNF]* 7.0
70.335 70.519 143.182 1,523.187 4+ 1,763.151 3+ Y[pH3N4] 6.9
70.335 70.519 143.182 1,523.187 4+ 1,690.126 3+ Y[pH2N3F] 6.2
70.335 70.519 143.182 1,523.187 4+ 1,398.019 3+ Y[pN] 6.2
70.335 70.519 143.182 1,523.187 4+ 1,450.413 4+ Y[pH4N5F] 5.8

Spectra

14692;EThcD;70.326;14690;1523.448;Byonic:q-value=0.000127/GPS:MinICScore=45.746
14694;HCD;70.335;14690;1523.448;